Description_x000D_ General description_x000D_ ACSL1 is an isozyme that belongs to the long-chain fatty-acid-coenzyme A ligase family. This enzyme converts free long-chain fatty acids into fatty acyl-CoA esters. Thus, it regulates lipid synthesis and fatty acid breakdown. Studies in bovine mammary glands have reported that ACSL1 modulates the channelling of fatty acids towards milk fat formation._x000D_ Rabbit Anti-ACSL1 (AB1) antibody recognizes pig, bovine, zebrafish, human, mouse, rat, and canine ACSL1._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the C terminal region of human ACSL1_x000D_ Application_x000D_ Rabbit Anti-ACSL1 (AB1) antibody can be used for western blot applications at a concentration of 1 μg/ml._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ ACSL1 encodes an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: GSFEELCRNKDVKKAILEDMVRLGKDSGLKPFEQVKGITLHPELFSIDNG