Перейти к контенту
Main image
Печать
Anti-ADAM7
Кат. №: AV53618
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-ADAM7
Main image
Кат. №: AV53618
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-ADAM7
Кат. №: AV53618
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ ADAM7 (ADAM metallopeptidase domain 7) gene encodes a single-pass type I membrane protein that belongs to ADAMs family of zinc proteases and is expressed in melanoma cells. It has a role in epididymosomes and is an integral plasma membrane protein in sperm that has unique secretory feature and interactive relationship during epididymis-to-sperm transfer process. Mutation in ADAM7 gene results in melanoma progression._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the C terminal region of human ADAM7_x000D_ Application_x000D_ Anti-ADAM7 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ Adam7 resides in an intracellular compartment of epididymal cells and is transferred to sperm membranes, where its levels are dependent on the expression of Adam2 and Adam3, which play critical roles in fertilization. It functions in fertilization through the formation of a chaperone complex and enhances association with integral membrane protein 2B (Itm2b) during capacitation in sperm. It also helps in the maturation of sperm cells in mammals and also plays a unique secretory feature and interactive relationship with sperm._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSRGIADPNQSAK
Related Categories
AD-AD, Alphabetical Index, Antibodies, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ ADAM7 (ADAM metallopeptidase domain 7) gene encodes a single-pass type I membrane protein that belongs to ADAMs family of zinc proteases and is expressed in melanoma cells. It has a role in epididymosomes and is an integral plasma membrane protein in sperm that has unique secretory feature and interactive relationship during epididymis-to-sperm transfer process. Mutation in ADAM7 gene results in melanoma progression._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the C terminal region of human ADAM7_x000D_ Application_x000D_ Anti-ADAM7 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ Adam7 resides in an intracellular compartment of epididymal cells and is transferred to sperm membranes, where its levels are dependent on the expression of Adam2 and Adam3, which play critical roles in fertilization. It functions in fertilization through the formation of a chaperone complex and enhances association with integral membrane protein 2B (Itm2b) during capacitation in sperm. It also helps in the maturation of sperm cells in mammals and also plays a unique secretory feature and interactive relationship with sperm._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: PTETLGVENKGYFGDEQQIRTEPILPEIHFLNKPASKDSRGIADPNQSAK
Related Categories
AD-AD, Alphabetical Index, Antibodies, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.