Печать
Anti-AKT1
Кат. №: AV06008
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-AKT1
Кат. №: AV06008
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; Akt kinases participate in multiple signal transduction pathways and important cellular processes such as proliferation, survival, migration and angiogenesis.; Immunogen; Synthetic peptide directed towards the N terminal region of human AKT1; Application; Anti-AKT1 antibody is suitable for western blotting at a concentration of 0.25 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Although upregulation of Akt1 activity is rarely reported in cancers, mutations in Akt1 gene have been identified in many malignancies. Akt1 regulates homologous recombination and maintains genetic stability in breast cancer cells.; Sequence; Synthetic peptide located within the following region: RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEK
Properties
AE-AK Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
