Перейти к контенту
Main image
Печать
Anti-ALAD
Кат. №: AV41657-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-ALAD
Main image
Кат. №: AV41657-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-ALAD
Кат. №: AV41657-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ Delta-Aminolevulinate dehydratase (Porphobilinogen synthase, ALA dehydratase), a zinc metalloenzyme, catalyzes the second step of porphyrin biosynthesis and the first common step in the biosynthesis of all biological tetrapyrroles including hemes, chlorophylls and vitamin B12. Hereditary insufficiency of porphobilinogen synthase causes porphobilinogen synthase (or ALA dehydratase) deficiency poprhyria. In addition to heme biosynthesis ALAD may be an important proteosome interacting protein._x000D_ Specificity_x000D_ Anti-ALAD (AB2) antibody detects bovine, human, mouse, and rat porphobilinogen synthase (delta-aminolevulinate dehydratase) enzymes._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the middle region of human ALAD_x000D_ Application_x000D_ Anti-ALAD (AB2) antibody is used to tag porphobilinogen synthase (delta-Aminolevulinate dehydratase) proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of this tetrapyrrole synthesizing enzyme in lead poisoning sensitivity, poprhyria and possibly some cancers._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ The cytosolic ALAD (δ-aminolevulinic acid dehydratase) plays a vital role in the heme biosynthetic pathway. It facilitates the second step, which is a condensation reaction of 5-aminolevulinic acid and forms a monopyrrole termed as porphobilinogen. It is one of the main targets of lead toxicity. Lead replaces zinc present in ALAD, leading to inactivation of the enzyme. Deficiency in ALAD causes ALAD deficiency porphyria (ADP)._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: SVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRD
Related Categories
AL-AL, Alphabetical Index, Antibodies, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ Delta-Aminolevulinate dehydratase (Porphobilinogen synthase, ALA dehydratase), a zinc metalloenzyme, catalyzes the second step of porphyrin biosynthesis and the first common step in the biosynthesis of all biological tetrapyrroles including hemes, chlorophylls and vitamin B12. Hereditary insufficiency of porphobilinogen synthase causes porphobilinogen synthase (or ALA dehydratase) deficiency poprhyria. In addition to heme biosynthesis ALAD may be an important proteosome interacting protein._x000D_ Specificity_x000D_ Anti-ALAD (AB2) antibody detects bovine, human, mouse, and rat porphobilinogen synthase (delta-aminolevulinate dehydratase) enzymes._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the middle region of human ALAD_x000D_ Application_x000D_ Anti-ALAD (AB2) antibody is used to tag porphobilinogen synthase (delta-Aminolevulinate dehydratase) proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of this tetrapyrrole synthesizing enzyme in lead poisoning sensitivity, poprhyria and possibly some cancers._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ The cytosolic ALAD (δ-aminolevulinic acid dehydratase) plays a vital role in the heme biosynthetic pathway. It facilitates the second step, which is a condensation reaction of 5-aminolevulinic acid and forms a monopyrrole termed as porphobilinogen. It is one of the main targets of lead toxicity. Lead replaces zinc present in ALAD, leading to inactivation of the enzyme. Deficiency in ALAD causes ALAD deficiency porphyria (ADP)._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: SVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRD
Related Categories
AL-AL, Alphabetical Index, Antibodies, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.