Description; General description; Arachidonate 15-lipoxygenase, type B (ALOX15B) is an arachidonate metabolizing enzyme that catalyzes the oxidation of arachidonate to (5Z,8Z,11Z,13E)-(15S)-15-hydroperoxyicosa-5,8,11,13-tetraenoate (15-HPETE). Arachidonate 15-lipoxygenases and its products are implicated in the pathogenesis of a variety of inflammatory disorders such as arthritis, psoriasis, and asthma.; Specificity; Anti-ALOX15B polyclonal antibody reacts with bovine, human, mouse, rat, and canine arachidonate 15-lipoxygenase, type B.; Immunogen; Synthetic peptide directed towards the C terminal region of human ALOX15B; Application; Anti-ALOX15B polyclonal antibody is used to tag arachidonate 15-lipoxygenase, type B proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of ALOX15B in inflammatory disorders.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; ALOX15B is a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively.This gene encodes a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The encoded protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively. This gene is located in a cluster of related genes and a pseudogene that spans approximately 100 kilobases on the short arm of chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been described.; Sequence; Synthetic peptide located within the following region: ATCEGFIATLPPVNATCDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPR