Description; Immunogen; Synthetic peptide directed towards the C terminal region of human Anxa6; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; ANXA6 is a calcium-dependent, phospholipid-binding protein that belongs to the annexin family. It inhibits the activity of cytoplasmic phospholipase A2 and prevenst the transport of caveolin-1 from the Golgi complex. ANXA6 has been reported to regulate mitochondrial homeostasis by inhibiting Drp1 and blocking mitochondrial fission.; Sequence; Synthetic peptide located within the following region: SDTSGHFRRILISLATGHREEGGENLDQAREDAQVAAEILEIADTPSGDK