Description_x000D_ General description_x000D_ The protein encoded by this gene is a member of the apolipoprotein L family and may play a role in lipid exchange and transport throughout the body, as well as in reverse cholesterol transport from peripheral cells to the liver. Two transcript variants encoding two different isoforms have been found for this gene. Only one of the isoforms appears to be a secreted protein. (provided by RefSeq)_x000D_ Immunogen_x000D_ APOL4 (ENSP00000331089, 1 a.a. ~ 107 a.a) full-length human protein._x000D_ Sequence_x000D_ MGSWVQLITSVGTSGLFLGVRVREEGAGMRCSKTIQAGQWLDSSKGPLGPSPPPVPTAGYSSSFCVHYVNLLPGVLVLSVTSQYPHLSMALCQLAAHDWPRLSCVCV_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4