Перейти к контенту
Main image
Печать
Anti-AQP7
Кат. №: AV32802-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-AQP7
Main image
Кат. №: AV32802-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-AQP7
Кат. №: AV32802-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; Aquaporins (water channels) are integral membrane proteins that create pores to facilitate the transport of water (permeability) across biological membranes. Aquaporin 7 (AQP7), a member of a 13-member family of aquaporins, is expressed in the testis and it is believed to have a role in sperm motility. AQP7 is expressed on epidermal and dermal dendritic cells where it may have a role in the initiation of the primary immune response via the facilitation of antigen uptake. Aquaporin 7 (AQP7) is dynamically expressed in mouse uteri undergoing decidualization; Rabbit polyclonal anti-AQP7 antibody reacts with human aquaporin-7.; Immunogen; Synthetic peptide directed towards the C terminal region of human AQP7; Application; Rabbit Anti-AQP7 can be used for western blot applications at a concentration of 0.4μg/ml.; Rabbit polyclonal anti-AQP7 antibody is used to tag aquaporin-7 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence of aquaporin-7 in tissues and cells such as the testis, dentritic cells (DC) and uteri wherein it is involved in processes such as sperm motility, antigen uptake and decidualization.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Aquaporins/major intrinsic protein (MIP) are a family of water-selective membrane channels. Aquaporin 7 has greater sequence similarity with AQP3 and AQP9 and they may be a subfamily. Aquaporin 7 and AQP3 are at the same chromosomal location suggesting that 9p13 may be a site of an aquaporin cluster. Aquaporin 7 facilitates water, glycerol and urea transport. It may play an important role in sperm function.; Sequence; Synthetic peptide located within the following region: DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA
Properties
AO-AQ Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; General description; Aquaporins (water channels) are integral membrane proteins that create pores to facilitate the transport of water (permeability) across biological membranes. Aquaporin 7 (AQP7), a member of a 13-member family of aquaporins, is expressed in the testis and it is believed to have a role in sperm motility. AQP7 is expressed on epidermal and dermal dendritic cells where it may have a role in the initiation of the primary immune response via the facilitation of antigen uptake. Aquaporin 7 (AQP7) is dynamically expressed in mouse uteri undergoing decidualization; Rabbit polyclonal anti-AQP7 antibody reacts with human aquaporin-7.; Immunogen; Synthetic peptide directed towards the C terminal region of human AQP7; Application; Rabbit Anti-AQP7 can be used for western blot applications at a concentration of 0.4μg/ml.; Rabbit polyclonal anti-AQP7 antibody is used to tag aquaporin-7 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence of aquaporin-7 in tissues and cells such as the testis, dentritic cells (DC) and uteri wherein it is involved in processes such as sperm motility, antigen uptake and decidualization.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Aquaporins/major intrinsic protein (MIP) are a family of water-selective membrane channels. Aquaporin 7 has greater sequence similarity with AQP3 and AQP9 and they may be a subfamily. Aquaporin 7 and AQP3 are at the same chromosomal location suggesting that 9p13 may be a site of an aquaporin cluster. Aquaporin 7 facilitates water, glycerol and urea transport. It may play an important role in sperm function.; Sequence; Synthetic peptide located within the following region: DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA
Properties
AO-AQ Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.