Печать
Anti-ARID3A
Кат. №: AV32869-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-ARID3A
Кат. №: AV32869-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_
General description_x000D_
ARID3A is a transcription factor that is involved in somatic cell reprograming. This transcription factor has also been implicated in chromatin assembly and developmental plasticity._x000D_
Rabbit Anti-ARID3A antibody recognizes bovine, human, mouse, rat, and canine ARID3A._x000D_
Immunogen_x000D_
Synthetic peptide directed towards the middle region of human ARID3A_x000D_
Application_x000D_
Rabbit Anti-ARID3A antibody can be used for western blot assays at 0.25μg/ml._x000D_
Physical form_x000D_
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_
Disclaimer_x000D_
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_
Biochem/physiol Actions_x000D_
ARID3A is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It was found by its homology to the Drosophila dead ringer gene, which is important for normal embryogenesis. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification._x000D_
Sequence_x000D_
Synthetic peptide located within the following region: QAAIDSNRREGRRQSFGGSLFAYSPGGAHGMLSSPKLPVSSLGLAASTNG
Related Categories
AA - CA, AR-AR, Alphabetical Index, Antibodies, Antibodies for Chromatin Remodeling, Antibodies for Epigenetics and Nuclear Signaling, Antibodies in Chromatin Remodeling, Antibodies to Transcription Factors, Primary AntibodiesMore... conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
