Description_x000D_ General description_x000D_ BLOC1S1 is a component of the ubiquitously expressed BLOC1 multisubunit protein complex. BLOC1 is required for normal biogenesis of specialized organelles of the endosomal-lysosomal system, such as melanosomes and platelet dense granules._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N-terminal region of Human BLOC1S1_x000D_ Physical form_x000D_ Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: SPQPDVTMLSRLLKEHQAKQNERKELQEKRRREAITAATCLTEALVDHLN