Печать
Anti-C6ORF192
Кат. №: AV50202
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-C6ORF192
Кат. №: AV50202
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; C6ORF192 gene encodes for a solute carrier termed as SLC18B1 and is highly expressed in central and peripheral nervous system.; Immunogen; Synthetic peptide directed towards the N terminal region of human C6orf192; Application; Anti-C6ORF192 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; The exact function of C6orf192 remains unknown.This gene encodes a protein, which has high sequence similarity to rat, xenopus and zebrafish proteins. The protein function is unknown.; Sequence; Synthetic peptide located within the following region: ISAASVNLGSMMCYSILGPFFPKEAEKKGASNTIIGMIFGCFALFELLAS
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
