Перейти к контенту
Main image
Печать
Anti-CACNB1
Кат. №: AV34953-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-CACNB1
Main image
Кат. №: AV34953-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-CACNB1
Кат. №: AV34953-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; CACNB1 codes for a member of the calcium channel beta subunit protein family. It is known to modulate G protein function. CACNB1 has been implicated in zebrafish paralysis indicating its role in neuronal functions. Rabbit Anti-CACNB1 antibody recognizes canine, rabbit, bovine, human, mouse, rat, and zebrafish CACNB1.; Immunogen; Synthetic peptide directed towards the N terminal region of human CACNB1; Application; Rabbit Anti-CACNB1 antibody is suitable for western blot applications at a concentration of 1 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; The protein encoded by CACNB1 belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation.; Sequence; Synthetic peptide located within the following region: EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; General description; CACNB1 codes for a member of the calcium channel beta subunit protein family. It is known to modulate G protein function. CACNB1 has been implicated in zebrafish paralysis indicating its role in neuronal functions. Rabbit Anti-CACNB1 antibody recognizes canine, rabbit, bovine, human, mouse, rat, and zebrafish CACNB1.; Immunogen; Synthetic peptide directed towards the N terminal region of human CACNB1; Application; Rabbit Anti-CACNB1 antibody is suitable for western blot applications at a concentration of 1 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; The protein encoded by CACNB1 belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation.; Sequence; Synthetic peptide located within the following region: EVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSAESYTSRPSDS
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.