Description_x000D_ General description_x000D_ This gene is one of two Cys-Cys (CC) cytokine genes clustered on the q arm of chromosome 7. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for normal peripheral blood eosinophils and basophils. The product of this gene is one of three related chemokines that specifically activate chemokine receptor CCR3. This chemokine may contribute to the eosinophil accumulation in atopic diseases. (provided by RefSeq)_x000D_ Immunogen_x000D_ CCL26 (NP_006063.1, 1 a.a. ~ 94 a.a) full-length human protein._x000D_ Sequence_x000D_ MMGLSLASAVLLASLLSLHLGTATRGSDISKTCCFQYSHKPLPWTWVRSYEFTSNSCSQRAVIFTTKRGKKVCTHPRKKWVQKYISLLKTPKQL_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4