Description; General description; Cyclin-dependent kinase inhibitor 3 is an enzyme encoded by the CDKN3 gene in humans. CDKN3 (cyclin-dependent kinase inhibitor 3) gene also referred to as CDI1, CIP2, FLJ25787, KAP1, KAP or MGC70625 encodes a protein that belongs to dual specificity protein phosphatase family.; Immunogen; Synthetic peptide directed towards the C terminal region of human CDKN3; Application; Anti-CDKN3 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Cyclin-dependent kinase inhibitor 3 (CDKN3) regulates the mitosis through the CDC2 signaling axis. CDKN3 also possess the capability to interact with multiple cyclin-dependent kinases and hence may facilitate the cell cycle regulation. Increased expression of CDKN3 enhances the kinase-associated phosphatase activity that inhibits the G1/S transition of the cell cycle by dephosphorylating the cyclin dependent kinases. It promotes tumour genesis. It may play an important role in the development and proliferation of epithelial ovarian cancer (EOC).; Sequence; Synthetic peptide located within the following region: CKFKDVRRNVQKDTEELKSCGIQDIFVFCTRGELSKYRVPNLLDLYQQCG