Печать
Anti-CHD1L
Кат. №: AV36364-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-CHD1L
Кат. №: AV36364-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; Immunogen; Synthetic peptide directed towards the middle region of human CHD1L; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Chromodomain helicase DNA binding protein 1-like (CHD1L) is a DNA helicase and chromatin remodeling factor that is important in DNA repair. It converts ATP to poly (ADP-ribose) and regulates the chromatin relaxation during DNA repair. It has been identified as an oncogene that induces cell proliferation, apoptosis inhibition, G1/S phase transition and embryo development. CHD1L acts as a marker for prognosis of solid tumors such as hepatocellular carcinoma.; Sequence; Synthetic peptide located within the following region: DALPAAEGGSRDQEEGKNHMYLFEGKDYSKEPSKEDRKSFEQLVNLQKTL
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
