Печать
Anti-CLIC5
Кат. №: AV35263-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-CLIC5
Кат. №: AV35263-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; CLIC5 is a chloride intracellular channel protein involved in hair cell stereocilia formation. It reportedly stabilizes membrane-actin filament links at the base of stereocilia. It has a role in the growth and differentiation of C2C12 myoblasts.
Rabbit Anti-CLIC5 antibody recognizes human, mouse, rat, pig, zebrafish, chicken, canine, and bovine CLIC5.; Immunogen; Synthetic peptide directed towards the C terminal region of human CLIC5; Application; Rabbit Anti-CLIC5 antibody is suitable for western blot (0.25 μg/ml) and IHC (4-8 μg/ml) applications.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Chloride intracellular channels are involved in chloride ion transport within various subcellular compartments. CLIon Channel5 specifically associates with the cytoskeleton of placenta microvilli.; Sequence; Synthetic peptide located within the following region: YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
