Перейти к контенту
Main image
Печать
ANTI-CRY1 (N-TERMINAL) ANTIBODY PRODUCED
Кат. №: SAB2108906-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
ANTI-CRY1 (N-TERMINAL) ANTIBODY PRODUCED
Main image
Кат. №: SAB2108906-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
ANTI-CRY1 (N-TERMINAL) ANTIBODY PRODUCED
Кат. №: SAB2108906-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ CRY1 is the blue light-dependent regulator of the circadian feedback loop. CRY1 inhibits CLOCK NPAS2-ARNTL E box-mediated transcription. CRY1 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. CRY1 has no photolyase activity. CRY1 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus. CRY1 may inhibit CLOCK NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human CRY1_x000D_ Physical form_x000D_ Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF
Related Categories
Alphabetical Index, Antibodies, CR-CR, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ CRY1 is the blue light-dependent regulator of the circadian feedback loop. CRY1 inhibits CLOCK NPAS2-ARNTL E box-mediated transcription. CRY1 acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. CRY1 has no photolyase activity. CRY1 is capable of translocating circadian clock core proteins such as PER proteins to the nucleus. CRY1 may inhibit CLOCK NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human CRY1_x000D_ Physical form_x000D_ Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: KRFQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEKYGVPSLEELGF
Related Categories
Alphabetical Index, Antibodies, CR-CR, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.