Печать
Anti-CSGALNACT1
Кат. №: AV47434-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-CSGALNACT1
Кат. №: AV47434-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; Chondroitin sulfate N-acetylgalactosaminyltransferase 1 (CSGALNACT1) is a Golgi membrane protein that regulates the imitation of chondroitin sulphate (CS) biosynthesis. Studies in mouse have revealed that CSGALNACT1 is responsible for the synthesis of around half of the total CS chains present in epiphyseal cartilages.
Rabbit Anti-CSGALNACT1 antibody recognizes chicken, canine, zebrafish, bovine, human, mouse, and rat CSGALNACT1.; Immunogen; Synthetic peptide directed towards the N terminal region of human CSGALNACT1; Application; Rabbit Anti-CSGALNACT1 antibody is suitable for western blot applications at a concentration of 1 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; CSGALNACT1 is a transfers 1,4-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to the non-reducing end of glucuronic acid (GlcUA). It is required for addition of the first GalNAc to the core tetrasaccharide linker and for elongation of chondroitin chains.; Sequence; Synthetic peptide located within the following region: KAEVNAGVKLATEYAAVPFDSFTLQKVYQLETGLTRHPEEKPVRKDKRDE
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
