Description_x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human CSTF2_x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ CSTF2 is a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3′ end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3′-untranslated region of mRNAs.This gene encodes a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3′ end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3′-untranslated region of mRNAs. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQA