Перейти к контенту
Main image
Печать
Anti-CTPS
Кат. №: AV46069-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-CTPS
Main image
Кат. №: AV46069-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-CTPS
Кат. №: AV46069-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; Immunogen; Synthetic peptide directed towards the N terminal region of human CTPS; Application; Anti-CTPS (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; CTPS encodes an enzyme CTP synthase 1 that catalyzes the ATP-dependent conversion of UTP to CTP. It also plays a pivotal role in synthesis of nucleic acids and is vital for proper cell growth and development .; Sequence; Synthetic peptide located within the following region: SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; Immunogen; Synthetic peptide directed towards the N terminal region of human CTPS; Application; Anti-CTPS (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; CTPS encodes an enzyme CTP synthase 1 that catalyzes the ATP-dependent conversion of UTP to CTP. It also plays a pivotal role in synthesis of nucleic acids and is vital for proper cell growth and development .; Sequence; Synthetic peptide located within the following region: SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.