Description_x000D_ Immunogen_x000D_ Synthetic peptide directed towards the middle region of human CXCL1_x000D_ Application_x000D_ Anti-CXCL1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.0758 μg/ml._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ CXCL1 is a chemokine that binds to CXCR2 receptor and stimulates migration of asthmatic airway smooth muscle cells. Prostate stromal cells secrete CXCL1 in response to IL-1 that results in prostatic inflammation in early stages of prostate cancer formation._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: QSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN