Description_x000D_ General description_x000D_ This gene encodes cytochrome c, a component of the electron transport chain in mitochondria. The heme group of cytochrome c accepts electrons from the b-c1 complex and transfers electrons to the cytochrome oxidase complex. Cytochrome c is also involved in initiation of apoptosis. Upon release of cytochrome c to the cytoplasm, the protein binds apoptotic protease activating factor which activates the apoptotic initiator procaspase 9. Many cytochrome c pseudogenes exist, scattered throughout the human genome. (provided by RefSeq)_x000D_ Immunogen_x000D_ CYCS (NP_061820.1, 1 a.a. ~ 105 a.a) full-length human protein._x000D_ Sequence_x000D_ MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4