Печать
Anti-DFNA5
Кат. №: AV46106
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-DFNA5
Кат. №: AV46106
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; Immunogen; Synthetic peptide directed towards the C terminal region of human DFNA5; Application; Anti-DFNA5 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; DFNA5 gene encodes a protein non-syndromic hearing impairment protein 5 also referred to as autosomal dominant 5 that expresses in foetal cochlea. It plays a pivotal role in apoptosis and cell survival. DFNA5 cooperates with TP53 and facilitates the p53-regulated cellular response to genotoxic stress.; Sequence; Synthetic peptide located within the following region: AALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQR
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
