Description; General description; The members of E2F family of transcription factors bind to promoter regions and regulate cell proliferation.; Immunogen; Synthetic peptide directed towards the N terminal region of human E2F5; Application; Anti-E2F5 antibody produced in rabbit is suitable for western blotting at a concentration of 0.4 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Overexpression of E2F5 has been reported in solid tumors of breast, ovarian, colon and hepatocellular carcinoma. It is a transcription repressor with regulatory roles in cell proliferation, growth and cell cycle progression.; Sequence; Synthetic peptide located within the following region: KAEIEDLELKERELDQQKLLLQQSIKNVMDDSINNRFSYVTHEDICNCFN