Description; General description; EGLN2 (PHD1) is a prolyl hydroxylase that regulates the degradation of alpha subunit of HIF-1. Furthermore, PHD1 expression is modulated by ARNT during hypoxic conditions. Studies in mice have revealed that EGLN2 can block cancer growth. Rabbit Anti-EGLN2 antibody recognizes canine, human, mouse, and rat EGLN2.; Immunogen; Synthetic peptide directed towards the N terminal region of human EGLN2; Application; Rabbit Anti-EGLN2 antibody can be used for western blot applications at a concentration of 0.5 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; The hypoxia inducible factor (HIF) is a transcriptional complex which is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. EGLN2 encodes an enzyme responsible for this posttranslational modification. Alternative splicing of EGLN2 results in three transcript variants encoding different isoforms.; Sequence; Synthetic peptide located within the following region: SAGSGTPRATATSTTASPLRDGFGGQDGGELRPLQSEGAAALVTKGCQRL