Description_x000D_ Immunogen_x000D_ Synthetic peptide directed towards the middle region of human Elf3_x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ Elf3 is a transcriptional activator that binds and transactivates ETS sequences containing the consensus nucleotide core sequence GGA[AT]. Elf3 acts synergistically with POU2F3 to transactivate the SPRR2A promoter and with RUNX1 to transactivate the ANGPT1 promoter.Elf3 also transactivates collagenase, CCL20, CLND7, FLG, KRT8, NOS2, PTGS2, SPRR2B, TGFBR2 and TGM3 promoters. Elf3 represses KRT4 promoter activity.Elf3 is involved in mediating vascular inflammation. Elf3 may play an important role in epithelial cell differentiation and tumorigenesis. Elf3 may be a critical downstream effector of the ERBB2 signaling pathway. Elf3 may be associated with mammary gland development and involution. Elf3 plays an important role in the regulation of transcription with TATA-less promoters in preimplantation embryos, which is essential in preimplantation development._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: TATPQSSHASDSGGSDVDLDLTESKVFPRDGFPDYKKGEPKHGKRKRGRP