Description; General description; ELFN2 is characterized by leucine-rich repeat and reportedly has a role in innate immune system.; Immunogen; Synthetic peptide directed towards the N terminal region of human ELFN2; Application; Anti-ELFN2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; ELFN2 is a single-pass membrane protein. It contains 1 fibronectin type-III domain and 5 LRR (leucine-rich) repeats. The exact function of ELFN2 remains unknown.; Sequence; Synthetic peptide located within the following region: PVSHPTPYSTDAQREPDENSGFNPDEILSVEPPASSTTDASAGPAIKLHH