Перейти к контенту
Main image
Печать
Anti-FAM3C
Кат. №: AV44904-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-FAM3C
Main image
Кат. №: AV44904-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-FAM3C
Кат. №: AV44904-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; Immunogen; Synthetic peptide directed towards the C terminal region of human FAM3C; Application; Anti-FAM3C antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; FAM3C belongs to the family with sequence similarity 3 (FAM3) family and is a secreted cytokine that promotes epithelial to mesenchymal transition, metastasis and tumor formation in the epithelial cells. The activity of FAM3C is essential for formation of retinal lamina and the development of retina.; Sequence; Synthetic peptide located within the following region: DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; Immunogen; Synthetic peptide directed towards the C terminal region of human FAM3C; Application; Anti-FAM3C antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; FAM3C belongs to the family with sequence similarity 3 (FAM3) family and is a secreted cytokine that promotes epithelial to mesenchymal transition, metastasis and tumor formation in the epithelial cells. The activity of FAM3C is essential for formation of retinal lamina and the development of retina.; Sequence; Synthetic peptide located within the following region: DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.