Печать
ANTI-FBXO10
Кат. №: SAB2108128-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
ANTI-FBXO10
Кат. №: SAB2108128-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_
Immunogen_x000D_
Synthetic peptide directed towards the middle region of human FBXO10_x000D_
Physical form_x000D_
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_
Disclaimer_x000D_
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_
Biochem/physiol Actions_x000D_
Members of the F-box protein family, such as FBXO10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.Members of the F-box protein family, such as FBXO10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).[supplied by OMIM]._x000D_
Sequence_x000D_
Synthetic peptide located within the following region: SSSPKPGSKAGSQEAEVGSDGERVAQTPDSSDGGLSPSGEDEDEDQLMYR
Related Categories
Alphabetical Index, Antibodies, FB-FJ, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
