Печать
Anti-FLJ37300
Кат. №: AV34084-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-FLJ37300
Кат. №: AV34084-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; FLJ37300 is a Kinesin-like protein also known as KIF19. It has a molecular weight of 111 kDa and is expressed with the cytoskeleton.; Immunogen; Synthetic peptide directed towards the N terminal region of human FLJ37300; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; FLJ37300 is a hypothetical protein found on chromosome 17.; Sequence; Synthetic peptide located within the following region: EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGITEVSTINAKE
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
