Перейти к контенту
Main image
Печать
ANTI-FYN
Кат. №: SAB2108139-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
ANTI-FYN
Main image
Кат. №: SAB2108139-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
ANTI-FYN
Кат. №: SAB2108139-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ Tyrosine-protein kinase (FYN) is located on human chromosome 6q21. It is a 59 kDa protein with the attachment sites for saturated fatty acid addition in the N terminal, a unique region, a Src-homology 3 (SH3) domain, a Src-homology 2 (SH2) domain, a tyrosine kinase domain (SH1) and a C-terminal negative regulatory domain._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human FYN_x000D_ Application_x000D_ Anti-FYN antibody produced in rabbit has been used in immunoblotting._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ Tyrosine-protein kinase (FYN) is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist._x000D_ FYN controls mitogenic signals and regulates cell cycle entry and proliferation. Upregulation of FYN in thyroid carcinoma plays an important role in tumorigenesis. Overexpression of FYN in brain is linked to Alzheimer′s disease (AD). It is also involved in T-cell signalling, myelination, learning and memory, neuroinflammation, apoptosis and cell adhesion._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN
Related Categories
Alphabetical Index, Antibodies, FP-FZ, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ Tyrosine-protein kinase (FYN) is located on human chromosome 6q21. It is a 59 kDa protein with the attachment sites for saturated fatty acid addition in the N terminal, a unique region, a Src-homology 3 (SH3) domain, a Src-homology 2 (SH2) domain, a tyrosine kinase domain (SH1) and a C-terminal negative regulatory domain._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human FYN_x000D_ Application_x000D_ Anti-FYN antibody produced in rabbit has been used in immunoblotting._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ Tyrosine-protein kinase (FYN) is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist._x000D_ FYN controls mitogenic signals and regulates cell cycle entry and proliferation. Upregulation of FYN in thyroid carcinoma plays an important role in tumorigenesis. Overexpression of FYN in brain is linked to Alzheimer′s disease (AD). It is also involved in T-cell signalling, myelination, learning and memory, neuroinflammation, apoptosis and cell adhesion._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN
Related Categories
Alphabetical Index, Antibodies, FP-FZ, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.