Перейти к контенту
Main image
Печать
Anti-GLYATL2
Кат. №: AV49019-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-GLYATL2
Main image
Кат. №: AV49019-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-GLYATL2
Кат. №: AV49019-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; Immunogen; Synthetic peptide directed towards the middle region of human GLYATL2; Application; Anti-GLYATL2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Glycine-N-acyltransferase-like 2 (GLYATL2) is an enzyme associated with the endoplasmic reticulum and expressed in spinal cord, trachea, thyroid and salivary glands. This enzyme is involved in conjugation of the CoA ester of fatty acids to glycine.; Sequence; Synthetic peptide located within the following region: LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; Immunogen; Synthetic peptide directed towards the middle region of human GLYATL2; Application; Anti-GLYATL2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Glycine-N-acyltransferase-like 2 (GLYATL2) is an enzyme associated with the endoplasmic reticulum and expressed in spinal cord, trachea, thyroid and salivary glands. This enzyme is involved in conjugation of the CoA ester of fatty acids to glycine.; Sequence; Synthetic peptide located within the following region: LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.