Description_x000D_ General description_x000D_ Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5′ - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3′. (provided by RefSeq)_x000D_ Immunogen_x000D_ HBZ (NP_005323.1, 1 a.a. ~ 142 a.a) full-length human protein._x000D_ Sequence_x000D_ MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4