Перейти к контенту
Main image
Печать
Anti-HCG_1646157
Кат. №: AV50952-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-HCG_1646157
Main image
Кат. №: AV50952-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-HCG_1646157
Кат. №: AV50952-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; Immunogen; Synthetic peptide directed towards the middle region of human hCG_1646157; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; The amino acid sequence of hCG_1646157 is derived from an annotated genomic sequence (NT_024477) using gene prediction method: GNOMON, supported by mRNA and EST evidence. The exact function of hCG_1646157 remains unknown.; Sequence; Synthetic peptide located within the following region: PVPNNLHMAQNACECNKDETLCHQSSLKKQGQTHTEKKHECNQCGKAFKR
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; Immunogen; Synthetic peptide directed towards the middle region of human hCG_1646157; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; The amino acid sequence of hCG_1646157 is derived from an annotated genomic sequence (NT_024477) using gene prediction method: GNOMON, supported by mRNA and EST evidence. The exact function of hCG_1646157 remains unknown.; Sequence; Synthetic peptide located within the following region: PVPNNLHMAQNACECNKDETLCHQSSLKKQGQTHTEKKHECNQCGKAFKR
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.