Печать
Anti-HCG_2042202
Кат. №: AV51085
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-HCG_2042202
Кат. №: AV51085
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; Immunogen; Synthetic peptide directed towards the C terminal region of human hCG_2042202; Application; Anti-LOC649137 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; HCG_2042202 has been identified as zinc finger and SCAN domain containing 5C (ZSCAN5C) or ZNF495B or ZNF371. It is characterized by the presence of Krüppel-associated boxes or KRAB domain. Zinc finger proteins have diverse functions that include activation of transcription, regulation of apoptosis, protein folding, RNA packaging and lipid binding.; Sequence; Synthetic peptide located within the following region: HKRIHTGERPFKCKYCSKVFSHKGNLNVHQRTHSGEKPYKCPTCQKAFRQ
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
