Печать
Anti-HDAC6
Кат. №: AV31451-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-HDAC6
Кат. №: AV31451-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; HDAC6 is a histone deacetylase that associates with polyubiquitinated protein and also functions as a tubulin deacetylase. Additionally, HDAC6 is known to rescue neurodegeneration. It can also function as a mechanistic link between autophagy and ubiquitin-proteasome system during protein degradation.
Rabbit Anti-HDAC6 antibody recognizes canine, human, rat, bovine, and mouse HDAC6.; Immunogen; Synthetic peptide directed towards the N terminal region of human HDAC6; Application; Rabbit Anti-HDAC6 antibody can be used for western blot applications at 1.0μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein belongs to class II of the histone deacetylase/acuc/apha family. It contains an internal duplication of two catalytic domains which appear to function independently of each other. This protein possesses histone deacetylase activity and represses transcription.; Sequence; Synthetic peptide located within the following region: VGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQ
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
