Печать
Anti-HMG20A
Кат. №: AV39340-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-HMG20A
Кат. №: AV39340-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; HMG20A is a homeobox gene that is expressed ubiquitously. Studies in CHO-K1 cells have reported that it interacts with the poxvirus protein, CP77, and modulates its dissociation from the genome of vaccinia virus.
Rabbit Anti-HMG20A antibody recognizes bovine, human, mouse, rat, canine, and chicken HMG20A.; Immunogen; Synthetic peptide directed towards the C terminal region of human HMG20A; Application; Rabbit Anti-HMG20A antibody is suitable for western blot applications at a concentration of 0.25 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; HMG20A plays a role in neuronal differentiation as chromatin-associated protein. HMG20A acts as inhibitor of HMG20B. HMG20A overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. HMG20A involved in the recruitment of the histone methyltransferase MLL and consequent increased methylation of histone H3 lysine 4; Sequence; Synthetic peptide located within the following region: SMPLPGSGETPTVDTIDSYMNRLHSIILANPQDNENFIATVREVVNRLDR
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
