Перейти к контенту
Main image
Печать
Anti-HMG20A
Кат. №: SAB2101047-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-HMG20A
Main image
Кат. №: SAB2101047-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-HMG20A
Кат. №: SAB2101047-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ HMG20A (high mobility group 20A) is located on human chromosome 15q24. It is a high mobility group (HMG) domain-containing protein._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human HMG20A_x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ HMG20A (high mobility group 20A) plays a role in neuronal differentiation as chromatin-associated protein. It overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. The protein also acts as an inhibitor of HMG20B. It involved in the recruitment of the histone methyltransferase MLL and consequent increased methylation of histone H3 lysine 4._x000D_ HMG20A is essential for SNAI1 (snail family transcriptional repressor 1)-mediated epithelial to mesenchymal transition._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: ENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPEF
Related Categories
Alphabetical Index, Antibodies, Antibodies for Epigenetics and Nuclear Signaling, Antibodies to Transcription Factors, GA - HN, HJ-HO, Primary AntibodiesMore... conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ HMG20A (high mobility group 20A) is located on human chromosome 15q24. It is a high mobility group (HMG) domain-containing protein._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human HMG20A_x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ HMG20A (high mobility group 20A) plays a role in neuronal differentiation as chromatin-associated protein. It overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. The protein also acts as an inhibitor of HMG20B. It involved in the recruitment of the histone methyltransferase MLL and consequent increased methylation of histone H3 lysine 4._x000D_ HMG20A is essential for SNAI1 (snail family transcriptional repressor 1)-mediated epithelial to mesenchymal transition._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: ENLMTSSTLPPLFADEDGSKESNDLATTGLNHPEVPYSSGATSSTNNPEF
Related Categories
Alphabetical Index, Antibodies, Antibodies for Epigenetics and Nuclear Signaling, Antibodies to Transcription Factors, GA - HN, HJ-HO, Primary AntibodiesMore... conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.