Перейти к контенту
Main image
Печать
ANTI-HNF1A
Кат. №: SAB2108302-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
ANTI-HNF1A
Main image
Кат. №: SAB2108302-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
ANTI-HNF1A
Кат. №: SAB2108302-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ Hepatocyte nuclear factor 1α (HNF1α) is a transcription factor that belongs to the liver enriched transcription factor family. It has a N-terminal dimerization domain (amino acids 1–32), a POU-homeobox DNA binding domain (amino acids 150-280) and a C-terminal transactivation domain (amino acids 281-631). HNF1A is located on human chromosome 12q24._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human HNF1A_x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ HNF1A is required for the expression of several liver specific genes. HNF1A binds to the inverted palindrome 5′-GTTAATNATTAAC-3′._x000D_ Hepatocyte nuclear factor 1α (HNF1α) modulates hepatocyte functions. It plays an important role in the modulation of gene expression and replication of hepatitis B virus (HBV). HNF1α is involved in lipid metabolism, gluconeogenesis and deoxygenation of xenobiotics. It stimulates the expression of the preS1 mRNA to induce the production of LHBs (viral large surface protein). Mutations in hepatocyte nuclear factor-1A (HNF1A) results in maturity-onset diabetes of the young type 3 (MODY3)._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE
Related Categories
Alphabetical Index, Antibodies, HJ-HO, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ Hepatocyte nuclear factor 1α (HNF1α) is a transcription factor that belongs to the liver enriched transcription factor family. It has a N-terminal dimerization domain (amino acids 1–32), a POU-homeobox DNA binding domain (amino acids 150-280) and a C-terminal transactivation domain (amino acids 281-631). HNF1A is located on human chromosome 12q24._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human HNF1A_x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ HNF1A is required for the expression of several liver specific genes. HNF1A binds to the inverted palindrome 5′-GTTAATNATTAAC-3′._x000D_ Hepatocyte nuclear factor 1α (HNF1α) modulates hepatocyte functions. It plays an important role in the modulation of gene expression and replication of hepatitis B virus (HBV). HNF1α is involved in lipid metabolism, gluconeogenesis and deoxygenation of xenobiotics. It stimulates the expression of the preS1 mRNA to induce the production of LHBs (viral large surface protein). Mutations in hepatocyte nuclear factor-1A (HNF1A) results in maturity-onset diabetes of the young type 3 (MODY3)._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE
Related Categories
Alphabetical Index, Antibodies, HJ-HO, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.