Перейти к контенту
Main image
Печать
ANTI-IAPP (N-TERMINAL) ANTIBODY PRODUCE
Кат. №: SAB2109030-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
ANTI-IAPP (N-TERMINAL) ANTIBODY PRODUCE
Main image
Кат. №: SAB2109030-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
ANTI-IAPP (N-TERMINAL) ANTIBODY PRODUCE
Кат. №: SAB2109030-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description_x000D_ General description_x000D_ Islet, or insulinoma, amyloid polypeptide is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the assosciation of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Studies suggest that amylin, like the related beta-amyloid (Abeta) associated with Alzheimer′s disease, can induce apoptotic cell-death in particular cultured cells, an effect that may be relevant to the development of type II diabetes._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human IAPP_x000D_ Physical form_x000D_ Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLV
Related Categories
Alphabetical Index, Antibodies, I-IG, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description_x000D_ General description_x000D_ Islet, or insulinoma, amyloid polypeptide is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the assosciation of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Studies suggest that amylin, like the related beta-amyloid (Abeta) associated with Alzheimer′s disease, can induce apoptotic cell-death in particular cultured cells, an effect that may be relevant to the development of type II diabetes._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human IAPP_x000D_ Physical form_x000D_ Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide_x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLV
Related Categories
Alphabetical Index, Antibodies, I-IG, Primary Antibodies conjugate
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.