Description_x000D_ General description_x000D_ The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. (provided by RefSeq)_x000D_ Immunogen_x000D_ IL3 (AAH69472.1, 1 a.a. ~ 152 a.a) full-length human protein._x000D_ Sequence_x000D_ MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4