Перейти к контенту
Main image
Печать
Anti-IRAK3
Кат. №: AV40709
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-IRAK3
Main image
Кат. №: AV40709
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-IRAK3
Кат. №: AV40709
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; Immunogen; Synthetic peptide directed towards the C terminal region of human IRAK3; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; IRAK3 contains 1 protein kinase domain and 1 death domain and belongs to the Ser/Thr protein kinase family, Pelle subfamily. It inhibits dissociation of IRAK1 and IRAK4 from the Toll-like receptor signaling complex by either inhibiting the phosphorylation of IRAK1 and IRAK4 or stabilizing the receptor complex.; Sequence; Synthetic peptide located within the following region: NTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; Immunogen; Synthetic peptide directed towards the C terminal region of human IRAK3; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; IRAK3 contains 1 protein kinase domain and 1 death domain and belongs to the Ser/Thr protein kinase family, Pelle subfamily. It inhibits dissociation of IRAK1 and IRAK4 from the Toll-like receptor signaling complex by either inhibiting the phosphorylation of IRAK1 and IRAK4 or stabilizing the receptor complex.; Sequence; Synthetic peptide located within the following region: NTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.