Перейти к контенту
Main image
Печать
Anti-IRF4
Кат. №: AV32669-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-IRF4
Main image
Кат. №: AV32669-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-IRF4
Кат. №: AV32669-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; IRF4 is a transcription factor that is expressed primarily in the lymphocytes. Studies in mice have shown that IRF4 deficiencies can cause lymphadenopathy. IRF4 defects can also lead to impaired cytotoxic and anti-cancer responses. Rabbit Anti-IRF4 antibody recognizes bovine, pig, zebrafish, chicken, canine, human, mouse, and rat IRF4.; Immunogen; Synthetic peptide directed towards the N terminal region of human IRF4; Application; Rabbit Anti-IRF4 antibody can be used for western blot applications at a concentration of 5μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; IFN regulatory factor (IRF)-4 is a lymphoid/myeloid-restricted member of the IRF transcription factor family that plays an essential role in the homeostasis and function of mature lymphocytes. IRF-4 expression is tightly regulated in resting primary T cells and is transiently induced at the mRNA and protein levels after activation by Ag-mimetic stimuli such as TCR cross-linking or treatment with phorbol ester and calcium ionophore (PMA/ionomycin).; Sequence; Synthetic peptide located within the following region: LDISDPYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQ
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; General description; IRF4 is a transcription factor that is expressed primarily in the lymphocytes. Studies in mice have shown that IRF4 deficiencies can cause lymphadenopathy. IRF4 defects can also lead to impaired cytotoxic and anti-cancer responses. Rabbit Anti-IRF4 antibody recognizes bovine, pig, zebrafish, chicken, canine, human, mouse, and rat IRF4.; Immunogen; Synthetic peptide directed towards the N terminal region of human IRF4; Application; Rabbit Anti-IRF4 antibody can be used for western blot applications at a concentration of 5μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; IFN regulatory factor (IRF)-4 is a lymphoid/myeloid-restricted member of the IRF transcription factor family that plays an essential role in the homeostasis and function of mature lymphocytes. IRF-4 expression is tightly regulated in resting primary T cells and is transiently induced at the mRNA and protein levels after activation by Ag-mimetic stimuli such as TCR cross-linking or treatment with phorbol ester and calcium ionophore (PMA/ionomycin).; Sequence; Synthetic peptide located within the following region: LDISDPYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQ
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.