Description_x000D_ General description_x000D_ The JTV1 gene is located on chromosome 7p22 flanked by two genes, HRI and PMS2. JTV1 and HRI overlap slightly and are arranged in a tail-to-tail fashion. JTV1 and PMS2 are separated by approximately 200 base pairs and are arranged head-to-head. JTV1 is transcribed in the opposite direction compared to HRI and PMS2. The function of the JTV1 gene product is unknown. (provided by RefSeq)_x000D_ Immunogen_x000D_ JTV1 (NP_006294.2, 1 a.a. ~ 320 a.a) full-length human protein._x000D_ Sequence_x000D_ MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGEGNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVVLWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4_x000D_ Biochem/physiol Actions_x000D_ Aminoacyl tRNA synthetase complex interacting multifunctional protein 2 (AIMP2) is a scaffold protein which functions as a tumor suppressor. It stimulates the ubiquitin-mediated degradation of FUSE-binding protein (FUBP1), which is a transcription activator. AIMP2 activates tumor suppressor p53 and stimulates apoptosis. The assembly of macromolecular tRNA synthetase complex depends on AIMP2.