Description; General description; KLF3 is a transcriptional factor that regulates muscle-specific genes. It is known to interact with serum response factor (SRF) through KLF binding sites. Rabbit Anti-KLF3 antibody recognizes canine, human, mouse, rat, pig, chicken, and bovine KLF3.; Immunogen; Synthetic peptide directed towards the N terminal region of human KLF3; Application; Rabbit Anti-KLF3 antibody can be used for western blot applications at a concentration of 1.25μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; KLF3 is a zinc finger transcription factor that is known to function as a potent transcriptional repressor; Sequence; Synthetic peptide located within the following region: LSHGIQMEPVDLTVNKRSSPPSAGNSPSSLKFPSSHRRASPGLSMPSSSP