Description; General description; KLHL25 is a kelch-like family member that complexes with CUL3 to form E3 ubiquitin ligase complex. This complex is known to target hypophosphorylated 4E-BP1. Rabbit Anti-KLHL25 antibody recognizes canine, human, mouse, and rat KLHL25.; Immunogen; Synthetic peptide directed towards the N terminal region of human KLHL25; Application; Rabbit Anti-KLHL25 antibody is suitable for western blot applications at a concentration of 2 μg/ml.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Biochem/physiol Actions; KLHL25 is also known as ENC2. It is a BTB/POZ KELCH domain protein; Sequence; Synthetic peptide located within the following region: SRYFEAMFSHGLRESRDDTVNFQDNLHPEVLELLLDFAYSSRIAINEENA