Description_x000D_ General description_x000D_ Ligand of numb-protein X 1 (LNX1) is an E3 ubiquitin ligase which contains RING (Really Interesting New Gene) and PDZ (Post-synaptic density, 95 kDa, Discs large, Zona Occludens-1) domains. LNX1 may function as a signaling scaffold protein with a PDZ domain has been shown to bind KCNA4, PAK6, PLEKHG5, PKC-α1, TγK2 and PBK._x000D_ Specificity_x000D_ Anti-LNX1 polyclonal antibody reacts with bovine, canine, human, mouse, and rat ligand of numb-protein X 1 proteins._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the C terminal region of human LNX1_x000D_ Application_x000D_ Anti-LNX1 polyclonal antibody is used to tag ligand of numb-protein X 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of ligand of numb-protein X 1 as a signaling scaffold and E3 ubiquitin ligase._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ LNX1 is a membrane-bound protein that is involved in signal transduction and protein interactions. LNX1 is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing phosphotyrosine binding (PTB) domains. This protein may play an important role in tumorogenesis.This gene encodes a membrane-bound protein that is involved in signal transduction and protein interactions. The encoded product is an E3 ubiquitin-protein ligase, which mediates ubiquitination and subsequent proteasomal degradation of proteins containing phosphotyrosine binding (PTB) domains. This protein may play an important role in tumorogenesis. Alternatively spliced transcript variants encoding distinct isoforms have been described. A pseudogene, which is located on chromosome 17, has been identified for this gene._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: SHREWDLPIYVISVEPGGVISRDGRIKTGDILLNVDGVELTEVSRSEAVA