Перейти к контенту
Main image
Печать
Anti-LRRC26
Кат. №: AV44660-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Печать
Anti-LRRC26
Main image
Кат. №: AV44660-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Main image
Печать
Anti-LRRC26
Кат. №: AV44660-100UL
Производитель: Sigma-Aldrich
Кол-во:
Цена по запросу
Товар оформляется под заказ
Description; General description; Leucine-rich repeat (LRR)-containing protein 26 (LRRC26) functions as an auxiliary protein that complexes with and modulates the activation requirements of large-conductance, voltage- and calcium-activated potassium (BK, or K(Ca)1.1) and alkaline activated Slo channels. LRRC26 modulates the gating of a BK channel by enhancing the allosteric coupling between voltage-sensor activation and the channel′s closed-open transition.; Specificity; Anti-LRRC26 polyclonal antibody reacts with canine and human leucine-rich repeat (LRR)-containing protein 26 proteins.; Immunogen; Synthetic peptide directed towards the middle region of human LRRC26; Application; Anti-LRRC26 polyclonal antibody is used to tag leucine-rich repeat (LRR)-containing protein 26 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of leucine-rich repeat (LRR)-containing protein 26 as a modulator of BK channel hyperpolarization activation and Slo3 channel alkalization activation.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Sequence; Synthetic peptide located within the following region: LRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLA
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.
Description; General description; Leucine-rich repeat (LRR)-containing protein 26 (LRRC26) functions as an auxiliary protein that complexes with and modulates the activation requirements of large-conductance, voltage- and calcium-activated potassium (BK, or K(Ca)1.1) and alkaline activated Slo channels. LRRC26 modulates the gating of a BK channel by enhancing the allosteric coupling between voltage-sensor activation and the channel′s closed-open transition.; Specificity; Anti-LRRC26 polyclonal antibody reacts with canine and human leucine-rich repeat (LRR)-containing protein 26 proteins.; Immunogen; Synthetic peptide directed towards the middle region of human LRRC26; Application; Anti-LRRC26 polyclonal antibody is used to tag leucine-rich repeat (LRR)-containing protein 26 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of leucine-rich repeat (LRR)-containing protein 26 as a modulator of BK channel hyperpolarization activation and Slo3 channel alkalization activation.; Physical form; Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Disclaimer; Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.; Sequence; Synthetic peptide located within the following region: LRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLA
Properties
Alphabetical Index Related Categories
Дорогой клиент, на сайте внедрена нейросеть для сбора информации о товаре. Это может привести к незначительным расхождениям в характеристиках продукции.