Description_x000D_ General description_x000D_ MEIS2 is a homeobox protein that is involved in the development of lens and retina. It is also known to compete with Tle4 for Otx2 binding and modulates tectal fate._x000D_ Rabbit Anti-MEIS2 antibody recognizes chicken, human, mouse, rat, zebrafish, canine, and bovine MEIS2._x000D_ Immunogen_x000D_ Synthetic peptide directed towards the N terminal region of human MEIS2_x000D_ Application_x000D_ Rabbit Anti-MEIS2 antibody is suitable for western blot (1.25 μg/ml) and IHC (4-8 μg/ml) applications._x000D_ Physical form_x000D_ Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose._x000D_ Disclaimer_x000D_ Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals._x000D_ Biochem/physiol Actions_x000D_ MEIS2 encodes a homeobox protein belonging to the TALE (′three amino acid loop extension′) family of homeodomain-containing proteins. TALE homeobox proteins are highly conserved transcription regulators, and several members have been shown to be essential contributors to developmental programs._x000D_ Sequence_x000D_ Synthetic peptide located within the following region: HYGAHAPHPNVMPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELA