Description_x000D_ General description_x000D_ This gene encodes a mitochondrial inner membrane protein that is implicated in the metabolism of reactive oxygen species. Mutations in this gene have been associated with the hepatocerebral form of mitochondrial DNA depletion syndrome (MDDS). (provided by RefSeq)_x000D_ Immunogen_x000D_ MPV17 (NP_002428.1, 1 a.a. ~ 176 a.a) full-length human protein._x000D_ Sequence_x000D_ MALWRAYQRALAAHPWKVQVLTAGSLMGLGDIISQQLVERRGLQEHQRGRTLTMVSLGCGFVGPVVGGWYKVLDRFIPGTTKVDALKKMLLDQGGFAPCFLGCFLPLVGALNGLSAQDNWAKLQRDYPDALITNYYLWPAVQLANFYLVPLHYRLAVVQCVAVIWNSYLSWKAHRL_x000D_ Physical form_x000D_ Solution in phosphate buffered saline, pH 7.4